ACTN1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB583986
| Article Name: |
ACTN1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB583986 |
| Supplier Catalog Number: |
orb583986 |
| Alternative Catalog Number: |
BYT-ORB583986-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human, Rat |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human ACTN1 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
BDPLT15 |
| Rabbit polyclonal antibody to ACTN1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
103kDa |
| NCBI: |
001093 |
| UniProt: |
P12814 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
| Target: |
ACTN1 |
![]()
|
Sample Type: 1.-4. rACTN1-GFP + HEK293 (50 ug), Primary dilution: 1:1000-1:2000, Secondary Antibody: HRP conjugated goat anti-rabbit, Secondary dilution: 1:20000. |
![]()
|
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. |
![]()
|
ACTN1 antibody - N-terminal region (orb583986) validated by WB using 1.-2.Rat cortical neurons ctr siRNA (30 ug), 2. Rat cortical neurons ACTN1 siRNA (30 ug) at 1:1000-1:2000. |
![]()
|
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml. |
![]()
|
Lanes: Lane 1: 10 ug ACTN1-GFP transfected COS-7 lysate, Lane 2: 10 ug ACTN2-GFP transfected COS-7 lysate, Lane 3: 10 ug ACTN3-GFP transfected COS-7 lysate, Lane 4: 10 ug ACTN4-GFP transfected COS-7 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: ACTN1. |
![]()
|
Sample Type: ACTNX-GFP transfected COS-7 cells, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-Alexa-Fluor 568, Secondary Antibody dilution: 1:100, Color/Signal Descriptions: Green: GFP Red: ACTN1, Gene Name: ACTN1. |
![]()
|
WB Suggested Anti-ACTN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. |
