Mouse IL13 protein

Catalog Number: BYT-ORB594829
Article Name: Mouse IL13 protein
Biozol Catalog Number: BYT-ORB594829
Supplier Catalog Number: orb594829
Alternative Catalog Number: BYT-ORB594829-10,BYT-ORB594829-50,BYT-ORB594829-500,BYT-ORB594829-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interleukin-13, IL-13, T-Cell Activation Protein P600, Il13, Il-13
This Mouse IL13 protein spans the amino acid sequence from region 22-131aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 13.1 kDa
UniProt: P20109
Buffer: Lyophilized from a 0.2 µm filtered 1xPBS, pH 7.4
Source: Mus musculus (Mouse)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Application Notes: Biological Origin: Mus musculus (Mouse). Biological Activity: The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is 11.34 ng/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL