Mouse IL4 protein

Catalog Number: BYT-ORB594837
Article Name: Mouse IL4 protein
Biozol Catalog Number: BYT-ORB594837
Supplier Catalog Number: orb594837
Alternative Catalog Number: BYT-ORB594837-10,BYT-ORB594837-50,BYT-ORB594837-500,BYT-ORB594837-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interleukin-4, IL-4, IL4, B-cell IgG differentiation factor, B-cell growth factor 1, B-cell stimulatory factor 1, BSF-1, IGG1 induction factor, Lymphocyte stimulatory factor 1
This Mouse IL4 protein spans the amino acid sequence from region 21-140aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 14.6 kDa
UniProt: P07750
Buffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Source: Mus musculus (Mouse)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Application Notes: Biological Origin: Mus musculus (Mouse). Biological Activity: The ED50 as determined in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells is 0.035 ng/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL