Human RANKL protein

Catalog Number: BYT-ORB594839
Article Name: Human RANKL protein
Biozol Catalog Number: BYT-ORB594839
Supplier Catalog Number: orb594839
Alternative Catalog Number: BYT-ORB594839-10,BYT-ORB594839-50,BYT-ORB594839-500,BYT-ORB594839-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CD254, ODF, OPGL, RANK L, TNFSF11, CD254, Osteoclast differentiation factor, Receptor activator of nuclear factor kappa-B ligand, tumor necrosis factor ligand superfamily member 11
This Human RANKL protein spans the amino acid sequence from region 140-317aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 22.4 kDa
UniProt: O14788
Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Loaded Recombinant Human OPG-Fc on Pro A Biosensor, can bind Human RANKL with an affinity constant of 1.83 pM as determined in BLI assay. ②Loaded Human RANK-His on HIS1K Biosensor, can bind Human RANK L with an affinity constant of <1 pM as determined in BLI assay. Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL