Rabbit TNF protein

Catalog Number: BYT-ORB594859
Article Name: Rabbit TNF protein
Biozol Catalog Number: BYT-ORB594859
Supplier Catalog Number: orb594859
Alternative Catalog Number: BYT-ORB594859-10,BYT-ORB594859-50,BYT-ORB594859-500,BYT-ORB594859-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Tumor Necrosis Factor, Cachectin, TNF-Alpha, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, TNF, TNFA, TNFSF2
This Rabbit TNF protein spans the amino acid sequence from region 78-235aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 17.59 kDa
UniProt: P04924
Buffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 300 mM NaCl, pH 7.4
Source: Oryctolagus cuniculus (Rabbit)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: VTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL
Application Notes: Biological Origin: Oryctolagus cuniculus (Rabbit). Biological Activity: The ED50 as determined in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 3.5 pg/ml. Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL