Human CAPRIN1 protein

Catalog Number: BYT-ORB595081
Article Name: Human CAPRIN1 protein
Biozol Catalog Number: BYT-ORB595081
Supplier Catalog Number: orb595081
Alternative Catalog Number: BYT-ORB595081-20,BYT-ORB595081-100,BYT-ORB595081-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cell cycle-associated protein 1 (Cytoplasmic activation- and proliferation-associated protein 1) (GPI-anchored membrane protein 1) (GPI-anchored protein p137) (GPI-p137) (p137GPI) (Membrane component chromosome 11 surface marker 1) (RNA granule protein 105 GPIAP1) (GPIP137) (M11S1) (RNG105)
This Human CAPRIN1 protein spans the amino acid sequence from region 2-709aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 80.7 kDa
UniProt: Q14444
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: PSATSHSGSGSKSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAMKQILGVIDKKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDSTHNHQNGL
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Homo sapiens (Human) CAPRIN1.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Homo sapiens (Human) CAPRIN1.