Human ACTB protein

Catalog Number: BYT-ORB603889
Article Name: Human ACTB protein
Biozol Catalog Number: BYT-ORB603889
Supplier Catalog Number: orb603889
Alternative Catalog Number: BYT-ORB603889-20,BYT-ORB603889-100,BYT-ORB603889-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Beta-actin
This Human ACTB protein spans the amino acid sequence from region 1-375aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 49.2 kDa
UniProt: P60709
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERF
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTB.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTB.