Human Caspase 1 protein

Catalog Number: BYT-ORB603953
Article Name: Human Caspase 1 protein
Biozol Catalog Number: BYT-ORB603953
Supplier Catalog Number: orb603953
Alternative Catalog Number: BYT-ORB603953-20,BYT-ORB603953-100,BYT-ORB603953-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interleukin-1 beta convertase , IL-1BCInterleukin-1 beta-converting enzyme , ICE , IL-1 beta-converting enzymep45
This Human Caspase 1 protein spans the amino acid sequence from region 120-269aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 43.8 kDa
UniProt: P29466
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.