Rat Caveolin 1 protein

Catalog Number: BYT-ORB603955
Article Name: Rat Caveolin 1 protein
Biozol Catalog Number: BYT-ORB603955
Supplier Catalog Number: orb603955
Alternative Catalog Number: BYT-ORB603955-20,BYT-ORB603955-100,BYT-ORB603955-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cav
This Rat Caveolin 1 protein spans the amino acid sequence from region 2-178aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 27.9 kDa
UniProt: P41350
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQEEI
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.