Virus CYS4 protein

Catalog Number: BYT-ORB603960
Article Name: Virus CYS4 protein
Biozol Catalog Number: BYT-ORB603960
Supplier Catalog Number: orb603960
Alternative Catalog Number: BYT-ORB603960-20,BYT-ORB603960-100,BYT-ORB603960-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Beta-thionase (Serine sulfhydrase) (Sulfur transfer protein 4) (STR4)
This Virus CYS4 protein spans the amino acid sequence from region 1-345aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 42.0 kDa
UniProt: P32582
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTKSEQQADSRHNVIDLVGNTPLIALKKLPKALGIKPQIYAKLELYNPGGSIKDRIAKSMVEEAEASGRIHPSRSTLIEPTSGNTGIGLALIGAIKGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHIGVAKKLEKEIPGAVILDQYNNMMNPEAHYFGTGREIQRQLEDLNLFDNLRAVVAGAGTGGTISGISKYLKEQNDKIQIVGADPFGSILAQPENLNKTDITDYKVEGIGYDFVPQVL
Application Notes: Biological Origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.