Mouse MCP1 protein

Catalog Number: BYT-ORB603963
Article Name: Mouse MCP1 protein
Biozol Catalog Number: BYT-ORB603963
Supplier Catalog Number: orb603963
Alternative Catalog Number: BYT-ORB603963-20,BYT-ORB603963-100,BYT-ORB603963-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: HC11Monocyte chemoattractant protein 1Monocyte chemotactic and activating factor , MCAFMonocyte chemotactic protein 1 , MCP-1Monocyte secretory protein JESmall-inducible cytokine A2
This Mouse MCP1 protein spans the amino acid sequence from region 24-96aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 12.4 kDa
UniProt: P10148
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.