Human CCL20 protein

Catalog Number: BYT-ORB603964
Article Name: Human CCL20 protein
Biozol Catalog Number: BYT-ORB603964
Supplier Catalog Number: orb603964
Alternative Catalog Number: BYT-ORB603964-20,BYT-ORB603964-100,BYT-ORB603964-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Beta-chemokine exodus-1CC chemokine LAR, CLiver and activation-regulated chemokine, Macrophage inflammatory protein 3 alpha , MIP-3-alpha, Small-inducible cytokine A20
This Human CCL20 protein spans the amino acid sequence from region 27-95aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 34.9 kDa
UniProt: P78556
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKN
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.