Mouse Ctsl protein

Catalog Number: BYT-ORB604008
Article Name: Mouse Ctsl protein
Biozol Catalog Number: BYT-ORB604008
Supplier Catalog Number: orb604008
Alternative Catalog Number: BYT-ORB604008-1,BYT-ORB604008-100,BYT-ORB604008-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cathepsin L (Major excreted protein) (MEP) (p39 cysteine proteinase) (Ctsl1)
This Mouse Ctsl protein spans the amino acid sequence from region 114-288aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 26.2 kDa
UniProt: P06797
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGT
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Partial
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.