Human MMP20 protein

Catalog Number: BYT-ORB604251
Article Name: Human MMP20 protein
Biozol Catalog Number: BYT-ORB604251
Supplier Catalog Number: orb604251
Alternative Catalog Number: BYT-ORB604251-1,BYT-ORB604251-100,BYT-ORB604251-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Enamel metalloproteinase (Enamelysin)
This Human MMP20 protein spans the amino acid sequence from region 108-483aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 47.6 kDa
UniProt: O60882
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFF
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MMP20.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MMP20.