Human PML protein

Catalog Number: BYT-ORB604318
Article Name: Human PML protein
Biozol Catalog Number: BYT-ORB604318
Supplier Catalog Number: orb604318
Alternative Catalog Number: BYT-ORB604318-1,BYT-ORB604318-100,BYT-ORB604318-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Promyelocytic leukemia protein (RING finger protein 71) (Tripartite motif-containing protein 19) (MYL) (PP8675) (RNF71) (TRIM19)
This Human PML protein spans the amino acid sequence from region 59-239aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 27.9 kDa
UniProt: P29590
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEE
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PML.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PML.