Mouse Pparg protein

Catalog Number: BYT-ORB604324
Article Name: Mouse Pparg protein
Biozol Catalog Number: BYT-ORB604324
Supplier Catalog Number: orb604324
Alternative Catalog Number: BYT-ORB604324-1,BYT-ORB604324-100,BYT-ORB604324-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Pparg, Nr1c3, Peroxisome proliferator-activated receptor gamma, PPAR-gamma, Nuclear receptor subfamily 1 group C member 3
This Mouse Pparg protein spans the amino acid sequence from region 1-505aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 63.3 kDa
UniProt: P37238
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFP
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of Pparg was greater than 95% as determined by SEC-HPLC