Human TROVE2 protein

Catalog Number: BYT-ORB604437
Article Name: Human TROVE2 protein
Biozol Catalog Number: BYT-ORB604437
Supplier Catalog Number: orb604437
Alternative Catalog Number: BYT-ORB604437-1,BYT-ORB604437-100,BYT-ORB604437-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Ro 60KDA autoantigen, Sjoegren syndrome antigen A2Sjoegren syndrome type A antigen , SS-ATROVE domain family member 2
This product spans the sequence region 3-535aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 64.1 kDa
UniProt: P10155
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREH
Application Notes: Biological Origin: Homo sapiens (Human)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel