Virus G protein

Catalog Number: BYT-ORB604552
Article Name: Virus G protein
Biozol Catalog Number: BYT-ORB604552
Supplier Catalog Number: orb604552
Alternative Catalog Number: BYT-ORB604552-1,BYT-ORB604552-100,BYT-ORB604552-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: G, Glycoprotein G, Fragment
This Virus G protein spans the amino acid sequence from region 1-423aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 54.8 kDa
UniProt: P0C2X0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KFTIVFPHNQKGNWKNVPSNYHYCPSSSDLNWHNDLIGTAIQVKMPKSHKAIQADGWMCHASKWVTTCDFRWYGPKYITQSIRSFTPSVEQCKESIEQTKQGTWLNPGFPPQSCGYATVTDAEAVIVQVTPHHVLVDEYTGEWVDSQFINGKCSNYICPTVHNSTTWHSDYKVKGLCDSNLISMDITFFSEDGELSSLGKEGTGFRSNYFAYETGGKACKMQYCKHWGVRLPSGVWFEMADKDLFAAARFPECPE
Application Notes: Biological Origin: Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV). Application Notes: Partial
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia colitraY.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia colitraY.