Plant XERO2 protein

Catalog Number: BYT-ORB604637
Article Name: Plant XERO2 protein
Biozol Catalog Number: BYT-ORB604637
Supplier Catalog Number: orb604637
Alternative Catalog Number: BYT-ORB604637-1,BYT-ORB604637-100,BYT-ORB604637-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Low-temperature-induced protein LTI30 (LTI30)
This Plant XERO2 protein spans the amino acid sequence from region 1-193aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 28.4 kDa
UniProt: P42758
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Arabidopsis thaliana (Mouse-ear cress)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNSHQNQTGVQKKGITEKIMEKLPGHHGPTNTGVVHHEKKGMTEKVMEQLPGHHGATGTGGVHHEKKGMTEKVMEQLPGHHGSHQTGTNTTYGTTNTGGVHHEKKSVTEKVMEKLPGHHGSHQTGTNTAYGTNTNVVHHEKKGIAEKIKEQLPGHHGTHKTGTTTSYGNTGVVHHENKSTMDKIKEKLPGGHH
Application Notes: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Arabidopsis thaliana (Mouse-ear cress) XERO2.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Arabidopsis thaliana (Mouse-ear cress) XERO2.