Human KCNMA1 protein

Catalog Number: BYT-ORB604887
Article Name: Human KCNMA1 protein
Biozol Catalog Number: BYT-ORB604887
Supplier Catalog Number: orb604887
Alternative Catalog Number: BYT-ORB604887-1,BYT-ORB604887-100,BYT-ORB604887-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: BK channel (BKCA alpha) (Calcium-activated potassium channel, subfamily M subunit alpha-1) (K(VCA)alpha) (KCa1.1) (Maxi K channel) (MaxiK) (Slo-alpha) (Slo1) (Slowpoke homolog) (Slo homolog) (hSlo) (KCNMA) (SLO)
This Human KCNMA1 protein spans the amino acid sequence from region 411-560aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 20.0 kDa
UniProt: Q12791
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) KCNMA1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) KCNMA1.