Human IKZF1 protein

Catalog Number: BYT-ORB604907
Article Name: Human IKZF1 protein
Biozol Catalog Number: BYT-ORB604907
Supplier Catalog Number: orb604907
Alternative Catalog Number: BYT-ORB604907-1,BYT-ORB604907-100,BYT-ORB604907-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Ikaros family zinc finger protein 1 (Lymphoid transcription factor LyF-1) (IK1) (IKAROS) (LYF1) (ZNFN1A1)
This Human IKZF1 protein spans the amino acid sequence from region 1-477aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 56.8 kDa
UniProt: Q13422
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSA
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length of Isoform Ik7
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IKZF1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IKZF1.