Human CD274 protein

Catalog Number: BYT-ORB605286
Article Name: Human CD274 protein
Biozol Catalog Number: BYT-ORB605286
Supplier Catalog Number: orb605286
Alternative Catalog Number: BYT-ORB605286-1,BYT-ORB605286-100,BYT-ORB605286-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: PD-L1 (PDCD1 ligand 1) (Programmed death ligand 1) (hPD-L1) (B7 homolog 1) (B7-H1) (CD274)
This Human CD274 protein spans the amino acid sequence from region 19-238aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 52.7 kDa
UniProt: Q9NZQ7
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 µg/ml can bind Anti- PD-L1 mouse monoclonal antibody, the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL. Application Notes: Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 µg/ml can bind Anti- PD-L1 mouse monoclonal antibody, the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL.
The purity of CD274 was greater than 90% as determined by SEC-HPLC.