Plant XERO1 protein

Catalog Number: BYT-ORB605442
Article Name: Plant XERO1 protein
Biozol Catalog Number: BYT-ORB605442
Supplier Catalog Number: orb605442
Alternative Catalog Number: BYT-ORB605442-1,BYT-ORB605442-100,BYT-ORB605442-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: DHNX
This Plant XERO1 protein spans the amino acid sequence from region 1-128aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 15.5 kDa
UniProt: P25863
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Arabidopsis thaliana (Mouse-ear cress)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MESYQNQSGAQQTHQQLDQFGNPFPATTGAYGTAGGAPAVAEGGGLSGMLHRSGSSSSSSSEDDGLGGRRRKKKGITEKIKEKLPGHHDSNKTSSLGSTTTAYDTGTVHHEKKGMMEKIKEKLPGGHH
Application Notes: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: Full Length
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Arabidopsis thaliana (Mouse-ear cress) XERO1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Arabidopsis thaliana (Mouse-ear cress) XERO1.