Animal Carcinoscorpius rotundicauda Limulus clotting factor C protein

Catalog Number: BYT-ORB605490
Article Name: Animal Carcinoscorpius rotundicauda Limulus clotting factor C protein
Biozol Catalog Number: BYT-ORB605490
Supplier Catalog Number: orb605490
Alternative Catalog Number: BYT-ORB605490-1,BYT-ORB605490-100,BYT-ORB605490-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Limulus clotting factor C, FC, EC 3.4.21.84) [Cleaved into, Limulus clotting factor C heavy chain, Limulus clotting factor C light chain, Limulus clotting factor C chain A, Limulus clotting factor C chain B]
This Animal Carcinoscorpius rotundicauda Limulus clotting factor C protein spans the amino acid sequence from region 691-1019aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 39.2 kDa
UniProt: Q26422
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Carcinoscorpius rotundicauda (Mangrove horseshoe crab) (Limulus rotundicauda)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SSQPSTVDLASKVKLPEGHYRVGSRAIYTCESRYYELLGSQGRRCDSNGNWSGRPASCIPVCGRSDSPRSPFIWNGNSTEIGQWPWQAGISRWLADHNMWFLQCGGSLLNEKWIVTAAHCVTYSATAEIIDPNQFKMYLGKYYRDDSRDDDYVQVREALEIHVNPNYDPGNLNFDIALIQLKTPVTLTTRVQPICLPTDITTREHLKEGTLAVVTGWGLNENNTYSETIQQAVLPVVAASTCEEGYKEADLPLTV
Application Notes: Biological Origin: Carcinoscorpius rotundicauda (Mangrove horseshoe crab) (Limulus rotundicauda). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Carcinoscorpius rotundicauda (Mangrove horseshoe crab) (Limulus rotundicauda).
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Carcinoscorpius rotundicauda (Mangrove horseshoe crab) (Limulus rotundicauda).