Human ABCD1 protein

Catalog Number: BYT-ORB623974
Article Name: Human ABCD1 protein
Biozol Catalog Number: BYT-ORB623974
Supplier Catalog Number: orb623974
Alternative Catalog Number: BYT-ORB623974-20,BYT-ORB623974-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Adrenoleukodystrophy protein
This Human ABCD1 protein spans the amino acid sequence from region 1-745aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 84.9 kDa
UniProt: P33897
Buffer: Lyophilized from 20 mM Tris-HCl, 0.15 M NaCl, 0.05% FOS12, 6% Trehalose, pH 8.0
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: MPVLSRPRPWRGNTLKRTAVLLALAAYGAHKVYPLVRQCLAPARGLQAPAGEPTQEASGVAAAKAGMNRVFLQRLLWLLRLLFPRVLCRETGLLALHSAALVSRTFLSVYVARLDGRLARCIVRKDPRAFGWQLLQWLLIALPATFVNSAIRYLEGQLALSFRSRLVAHAYRLYFSQQTYYRVSNMDGRLRNPDQSLTEDVVAFAASVAHLYSNLTKPLLDVAVTSYTLLRAARSRGAGTAWPSAIAGLVVFLTA
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 µg/ml can bind human PEX19,the EC50 of human PEX19 protein is 22.96-33.00 µg/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 µg/ml can bind human PEX19, the EC50 of human PEX19 is 22.96-33.00 µg/ml.