Bacteria NDM-1 protein

Catalog Number: BYT-ORB624080
Article Name: Bacteria NDM-1 protein
Biozol Catalog Number: BYT-ORB624080
Supplier Catalog Number: orb624080
Alternative Catalog Number: BYT-ORB624080-20,BYT-ORB624080-100,BYT-ORB624080-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: /
This Bacteria NDM-1 protein spans the amino acid sequence from region 164-222aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 22 kDa
UniProt: F8UNN7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Acinetobacter baumannii
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG
Application Notes: Biological Origin: Acinetobacter baumannii. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Acinetobacter baumanniindm-1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Acinetobacter baumanniindm-1.