Human EFNA5 protein
Catalog Number:
BYT-ORB624106
- Images (3)
| Article Name: | Human EFNA5 protein |
| Biozol Catalog Number: | BYT-ORB624106 |
| Supplier Catalog Number: | orb624106 |
| Alternative Catalog Number: | BYT-ORB624106-20,BYT-ORB624106-100,BYT-ORB624106-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | AL-1 (EPH-related receptor tyrosine kinase ligand 7) (LERK-7) |
| This Human EFNA5 protein spans the amino acid sequence from region 21-203aa. Purity: Greater than 93% as determined by SDS-PAGE. |
| Molecular Weight: | 50.1 kDa |
| UniProt: | P52803 |
| Buffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Source: | Homo sapiens (Human) |
| Purity: | Greater than 93% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN |
| Application Notes: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 µg/ml can bind human EFNA5, the EC50 of human EFNA5 protein is 0.8674-1.119 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |



