Human GSTK1 protein

Catalog Number: BYT-ORB705312
Article Name: Human GSTK1 protein
Biozol Catalog Number: BYT-ORB705312
Supplier Catalog Number: orb705312
Alternative Catalog Number: BYT-ORB705312-20,BYT-ORB705312-100,BYT-ORB705312-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: GST 13-13 GST class-kappa GSTK1-1
This Human GSTK1 protein spans the amino acid sequence from region 2-226aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 52.4 kDa
UniProt: Q9Y2Q3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized HTR1B at 5 µg/ml can bind human GSTK1,the EC50 of human GSTK1 protein is 159.40-218.50 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized HTR1B at 5 µg/ml can bind human GSTK1, the EC50 of human GSTK1 protein is 159.40-218.50 ng/ml.