HP-0175 protein

Catalog Number: BYT-ORB705313
Article Name: HP-0175 protein
Biozol Catalog Number: BYT-ORB705313
Supplier Catalog Number: orb705313
Alternative Catalog Number: BYT-ORB705313-20,BYT-ORB705313-100,BYT-ORB705313-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Rotamase HP_0175
This HP-0175 protein spans the amino acid sequence from region 22-299aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 58.8 kDa
UniProt: P56112
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEK
Application Notes: Biological Origin: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized yuaB at 5 µg/ml can bind human HP_0175 with a linear range of 31.25-600.00 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized yuaB at 5 µg/ml can bind human HP_0175 with a linear range of 31.25-600.00 ng/ml.