Human ULBP1 protein
Catalog Number:
BYT-ORB705332
- Images (3)
| Article Name: | Human ULBP1 protein |
| Biozol Catalog Number: | BYT-ORB705332 |
| Supplier Catalog Number: | orb705332 |
| Alternative Catalog Number: | BYT-ORB705332-20,BYT-ORB705332-100,BYT-ORB705332-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | (ALCAN-beta) (NKG2D ligand 1) (N2DL-1) (NKG2DL1) (Retinoic acid early transcript 1I) |
| This Human ULBP1 protein spans the amino acid sequence from region 26-216aa. Purity: Greater than 93% as determined by SDS-PAGE. |
| Molecular Weight: | 52.4 kDa |
| UniProt: | Q9BZM6 |
| Buffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Source: | Homo sapiens (Human) |
| Purity: | Greater than 93% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG |
| Application Notes: | Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |



