Recombinant Macaca fascicularis glypican-3 (GPC3), partial

Catalog Number: CSB-MP7605MOV
Article Name: Recombinant Macaca fascicularis glypican-3 (GPC3), partial
Biozol Catalog Number: CSB-MP7605MOV
Supplier Catalog Number: CSB-MP7605MOV
Alternative Catalog Number: CSB-MP7605MOV-1, CSB-MP7605MOV-100, CSB-MP7605MOV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 62.5 kDa
Tag: C-terminal G4S-10xHis-tagged
UniProt: XP_005594665.1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 25-559aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCN
Application Notes: Research Areas: Others. Endotoxin: Not test