Recombinant Sus scrofa CCN family member 4 (CCN4)

Catalog Number: CSB-MP7652PI
Article Name: Recombinant Sus scrofa CCN family member 4 (CCN4)
Biozol Catalog Number: CSB-MP7652PI
Supplier Catalog Number: CSB-MP7652PI
Alternative Catalog Number: CSB-MP7652PI-1, CSB-MP7652PI-100, CSB-MP7652PI-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: WNT1-inducible-signaling pathway protein 1
Molecular Weight: 40.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: A0A287B123
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 20-371aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ASGSALATAFSPAPTAMAFTPAPLEDTSARPQFCKWPCECPPSPPRCPLGVSLITDGCECCKMCAQQLGDNCTEAATCDPHRGLYCDYSGDRPRYAVGVCAQVVGVGCVLDGVRYNNGQSFQPNCKYNCTCVDGAVGCTPLCLRVRPPRLWCRQPRRVSVPGRCCEQWVCDDDARRPRKTAPRHTGAFAATDEVEPWHRNCIAYTSPWSPCSTSCGLGVSTRISSVNPRCWPEQESRLCNLRPCDVDLRPRIKEG
Application Notes: Research Areas: Cancer. Endotoxin: Not test