Recombinant Pig Advanced glycosylation end product-specific receptor precursor (AGER), partial

Catalog Number: CSB-MP7717PI2-C
Article Name: Recombinant Pig Advanced glycosylation end product-specific receptor precursor (AGER), partial
Biozol Catalog Number: CSB-MP7717PI2-C
Supplier Catalog Number: CSB-MP7717PI2-C
Alternative Catalog Number: CSB-MP7717PI2-C-1, CSB-MP7717PI2-C-100, CSB-MP7717PI2-C-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 35.4 kDa
Tag: C-terminal 10xHis-tagged
UniProt: NP_001116690.1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 23-343aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DQNITARIGKPLVLNCKGAPKKPPQQLEWKLNTGRTEAWKVLTPQGGPWDSVARVLPNGSLLLPAVGIQDEGTFRCRATSRNGKETKSNYRVQVYQIPGKPDIVDPASELMAGVPNKVGTCVSEGGYPAGTLSWHLDGKTLIPDGKGVSVKEETRRHPETGLFTLHSELMVTPAWGGAPQPTFSCSFSPSFPRRRALHTAPIRPSVWEPVPLEEVQLVVEPAGGAVPPGGTVTLTCETSVQPPPQIHWTKDGTPL
Application Notes: Research Areas: Others