Recombinant Mouse Filamin-A (Flna), partial

Catalog Number: CSB-MP804854MO1
Article Name: Recombinant Mouse Filamin-A (Flna), partial
Biozol Catalog Number: CSB-MP804854MO1
Supplier Catalog Number: CSB-MP804854MO1
Alternative Catalog Number: CSB-MP804854MO1-1, CSB-MP804854MO1-100, CSB-MP804854MO1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Actin-binding protein 280,Alpha-filamin,Endothelial actin-binding protein,Filamin-1,Non-muscle filamin
Molecular Weight: 33.1 kDa
Tag: C-terminal G4S-10xHis-tagged
UniProt: Q8BTM8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 500-750aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWG
Application Notes: Research Areas: Others. Endotoxin: Not test