Recombinant Human Retinoic acid receptor responder protein 2 (RARRES2)

Catalog Number: CSB-MP857881HU
Article Name: Recombinant Human Retinoic acid receptor responder protein 2 (RARRES2)
Biozol Catalog Number: CSB-MP857881HU
Supplier Catalog Number: CSB-MP857881HU
Alternative Catalog Number: CSB-MP857881HU-1, CSB-MP857881HU-100, CSB-MP857881HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Chemerin,RAR-responsive protein TIG2,Tazarotene-induced gene 2 protein
Molecular Weight: 43.3 kDa
Tag: C-terminal hFc1-tagged
UniProt: Q99969
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.8.
Source: Mammalian cell
Expression System: 21-157aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS
Application Notes: Research Areas: Neuroscience