Recombinant Human Tumor necrosis factor receptor superfamily member 12A (TNFRSF12A), partial

Catalog Number: CSB-MP873605HU
Article Name: Recombinant Human Tumor necrosis factor receptor superfamily member 12A (TNFRSF12A), partial
Biozol Catalog Number: CSB-MP873605HU
Supplier Catalog Number: CSB-MP873605HU
Alternative Catalog Number: CSB-MP873605HU-1, CSB-MP873605HU-100, CSB-MP873605HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Fibroblast growth factor-inducible immediate-early response protein 14,Tweak-receptor
Molecular Weight: 32.8 kDa
Tag: N-terminal hFc1-tagged
UniProt: Q9NP84
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.169.
Source: Mammalian cell
Expression System: 28-79aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLW
Application Notes: Research Areas: Cancer