Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial

Catalog Number: CSB-MP883443HU(F7)M3
Article Name: Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial
Biozol Catalog Number: CSB-MP883443HU(F7)M3
Supplier Catalog Number: CSB-MP883443HU(F7)m3
Alternative Catalog Number: CSB-MP883443HU(F7)M3-1, CSB-MP883443HU(F7)M3-100, CSB-MP883443HU(F7)M3-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: BTL-II
Molecular Weight: 51.5 kDa
Tag: C-terminal Twin-Strep-tagged
UniProt: Q9UIR0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 24-457aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLKVAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSM
Application Notes: Research Areas: Immunology