Recombinant Human HERV-H_2q24.3 provirus ancestral Env polyprotein, partial

Catalog Number: CSB-MP885640HU
Article Name: Recombinant Human HERV-H_2q24.3 provirus ancestral Env polyprotein, partial
Biozol Catalog Number: CSB-MP885640HU
Supplier Catalog Number: CSB-MP885640HU
Alternative Catalog Number: CSB-MP885640HU-1, CSB-MP885640HU-100, CSB-MP885640HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Env protein HERV-H/p62,Env protein HERV-H19,Env protein HERV-Hcl.3,Envelope polyprotein,HERV-H/env62
Molecular Weight: 40.5 kDa
Tag: C-terminal G4S-10xHis-tagged
UniProt: Q9N2K0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 36-387aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LPLPSYLHHTINLTHSLLAASNPSLVNNCWLCISLSSSAYTAVPAVQTDWATSPISLHLRTSFNSPHLYPPEELIYFLDRSSKTSPDISHQQAAALLRTYLKNLSPYINSTPPIFGPLTTQTTIPVAAPLCISWQRPTGIPLGNLSPSRCSFTLHLRSPTTNINETIGAFQLHITDKPSINTDKLKNISSNYCLGRHLPCISLHPWLSSPCSSDSPPRPSSCLLIPSPENNSERLLVDTRRFLIHHENRTFPSTQ
Application Notes: Research Areas: Others. Endotoxin: Not test