Recombinant Human Interleukin-20 receptor subunit alpha (IL20RA), partial

Catalog Number: CSB-MP887035HU
Article Name: Recombinant Human Interleukin-20 receptor subunit alpha (IL20RA), partial
Biozol Catalog Number: CSB-MP887035HU
Supplier Catalog Number: CSB-MP887035HU
Alternative Catalog Number: CSB-MP887035HU-1, CSB-MP887035HU-100, CSB-MP887035HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Cytokine receptor class-II member 8,Cytokine receptor family 2 member 8,IL-20R1,ZcytoR7
Molecular Weight: 52.7 kDa
Tag: C-terminal hFc1-tagged
UniProt: Q9UHF4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 30-250aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK
Application Notes: Research Areas: Cancer