AMH antibody [5/6], IgG1, Unconjugated, Mouse, Monoclonal
Catalog Number:
GTX42793
- Images (0)
| Article Name: | AMH antibody [5/6], IgG1, Unconjugated, Mouse, Monoclonal |
| Biozol Catalog Number: | GTX42793 |
| Supplier Catalog Number: | GTX42793 |
| Alternative Catalog Number: | GTX42793-100 |
| Manufacturer: | GeneTex |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC-P, WB |
| Species Reactivity: | Human, Monkey, Mouse, Primate, Sheep |
| Immunogen: | Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC) |
| Conjugation: | Unconjugated |
| Alternative Names: | anti-Mullerian hormone , MIF , MIS |
| Application Notes: | IHC-P: 1/20-1/40. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications. |
