IHC-plus(TM) Polyclonal Rabbit anti-Human Calgizzarin / S100A11 Antibody (IHC, IF, WB) LS-B14896

Catalog Number: LS-B14896-50

Images (3)
See all images and image information

Article Name:	IHC-plus(TM) Polyclonal Rabbit anti-Human Calgizzarin / S100A11 Antibody (IHC, IF, WB) LS-B14896
Biozol Catalog Number:	LS-B14896-50
Supplier Catalog Number:	LS-B14896-50
Alternative Catalog Number:	LS-B14896-50
Manufacturer:	LifeSpan Biosciences
Host:	Rabbit
Category:	Antikörper
Application:	IF, IHC, IHC-P, WB
Species Reactivity:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1). MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
Conjugation:	Unconjugated
Alternative Names:	S100A11, Calgizzarin, MLN 70, MLN70, Protein S100-A11, Protein S100-C, S100C

S100A11 antibody LS-B14896 is an unconjugated rabbit polyclonal antibody to S100A11 (Calgizzarin) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.

Clonality:	Polyclonal
NCBI:	6282
Buffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity:	Affinity purified
Form:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Dilute:	IF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000)
Application Notes:	The predicted MW is 11kDa, while the observed MW by Western blot was 12kDa.

	Western blot analysis of extracts of various cell lines, using S100A11 antibody.
	Immunofluorescence analysis of U20S cell using S100A11 antibody. Blue: DAPI for nuclear staining.
	Immunohistochemistry of paraffin-embedded human kidney tissue.

* VAT and and shipping costs not included.
Errors and price changes excepted