Polyclonal Rabbit anti-Human IL8 / Interleukin 8 Antibody (IHC, WB) LS-C332151

Catalog Number: LS-C332151-20
Article Name: Polyclonal Rabbit anti-Human IL8 / Interleukin 8 Antibody (IHC, WB) LS-C332151
Biozol Catalog Number: LS-C332151-20
Supplier Catalog Number: LS-C332151-20
Alternative Catalog Number: LS-C332151-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-99 of human IL8 (NP_000575.1). EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Conjugation: Unconjugated
Alternative Names: CXCL8, 3-10C, AMCF-I, B-ENAP, C-X-C motif chemokine 8, GCP-1, IL-8, IL8, Interleukin-8, K60, LECT, GCP1, LUCT, NAF, NAP1, Neutrophil-activating factor, Interleukin 8, Protein 3-10C, MDNCF, TSG-1, Emoctakin, LYNAP, MONAP, NAP-1, SCYB8, T-cell chemotactic
Interleukin 8 antibody LS-C332151 is an unconjugated rabbit polyclonal antibody to human Interleukin 8 (IL8). Validated for IHC and WB.
Clonality: Polyclonal
NCBI: 3576
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 11kDa, while the observed MW by Western blot was 11kDa.
Western blot analysis of extracts of A431 cells.
Immunohistochemistry of paraffin-embedded mouse lung tissue.