Polyclonal Rabbit anti-Human GZMB / Granzyme B Antibody (IF, WB) LS-C332166

Catalog Number: LS-C332166-20
Article Name: Polyclonal Rabbit anti-Human GZMB / Granzyme B Antibody (IF, WB) LS-C332166
Biozol Catalog Number: LS-C332166-20
Supplier Catalog Number: LS-C332166-20
Alternative Catalog Number: LS-C332166-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 148-247 of human GZMB (NP_004122.2). GQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Conjugation: Unconjugated
Alternative Names: GZMB, CCPI, CGL-1, Cathepsin G-like 1, CSP-B, CTLA-1, CTLA1, CGL1, CSPB, Fragmentin 2, GRB, HLP, Human lymphocyte protein, Fragmentin-2, SECT, Lymphocyte protease, T-cell serine protease 1-3E, C11, CTSGL1, Cytotoxic serine protease B, Granzyme B, Granzym
Granzyme B antibody LS-C332166 is an unconjugated rabbit polyclonal antibody to Granzyme B (GZMB) from human. It is reactive with human and mouse. Validated for IF and WB.
Clonality: Polyclonal
NCBI: 3002
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IF (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 27kDa, while the observed MW by Western blot was 25kDa.
Western blot analysis of extracts of various cell lines.
Immunofluorescence analysis of U2OS cells.