Polyclonal Rabbit anti-Human DAP Antibody (IHC, IF, WB) LS-C334527

Catalog Number: LS-C334527-100
Article Name: Polyclonal Rabbit anti-Human DAP Antibody (IHC, IF, WB) LS-C334527
Biozol Catalog Number: LS-C334527-100
Supplier Catalog Number: LS-C334527-100
Alternative Catalog Number: LS-C334527-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human DAP (NP_004385.1). MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK
Conjugation: Unconjugated
Alternative Names: DAP, DAP-1, Death-associated protein 1, DAP1, Death-associated protein
DAP antibody LS-C334527 is an unconjugated rabbit polyclonal antibody to DAP from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Clonality: Polyclonal
NCBI: 1611
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IF (1:20 - 1:100), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 11kDa, while the observed MW by Western blot was 15kDa.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded rat kidney tissue.
Immunofluorescence analysis of MCF-7 cells.