Polyclonal Rabbit anti-Human MLANA / Melan-A Antibody (IHC, IF, WB) LS-C334620

Catalog Number: LS-C334620-50

Images (3)
See all images and image information

Article Name:	Polyclonal Rabbit anti-Human MLANA / Melan-A Antibody (IHC, IF, WB) LS-C334620
Biozol Catalog Number:	LS-C334620-50
Supplier Catalog Number:	LS-C334620-50
Alternative Catalog Number:	LS-C334620-50
Manufacturer:	LifeSpan Biosciences
Host:	Rabbit
Category:	Antikörper
Application:	IF, IHC, WB
Species Reactivity:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 48-118 of human MLANA (NP_005502.1). CRRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
Conjugation:	Unconjugated
Alternative Names:	MLANA, Antigen LB39-AA, Antigen SK29-AA, Melan-A, Protein Melan-A, MART-1, MART1, Melan A

Melan-A antibody LS-C334620 is an unconjugated rabbit polyclonal antibody to Melan-A (MLANA) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.

Clonality:	Polyclonal
NCBI:	2315
Buffer:	PBS, 50% glycerol, pH 7.3
Purity:	Affinity purified
Form:	PBS, 50% glycerol, pH 7.3

Application Dilute:	IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes:	The predicted MW is 13kDa, while the observed MW by Western blot was 18kDa.

	Western blot analysis of extracts of various cell lines, using MLANA antibody.
	Immunohistochemistry of paraffin-embedded Human liver injury tissue.
	Immunofluorescence analysis of U2OS cells.

* VAT and and shipping costs not included.
Errors and price changes excepted