Polyclonal Rabbit anti-Human FLNB / TAP Antibody (IHC, WB) LS-C335245

Catalog Number: LS-C335245-20

Images (2)
See all images and image information

Article Name:	Polyclonal Rabbit anti-Human FLNB / TAP Antibody (IHC, WB) LS-C335245
Biozol Catalog Number:	LS-C335245-20
Supplier Catalog Number:	LS-C335245-20
Alternative Catalog Number:	LS-C335245-20
Manufacturer:	LifeSpan Biosciences
Host:	Rabbit
Category:	Antikörper
Application:	IHC, WB
Species Reactivity:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1686-1785 of human FLNB (NP_001157789.1). PDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFA
Conjugation:	Unconjugated
Alternative Names:	FLNB, ABP-280, ABP-280 homolog, AOI, ABP-278, Actin binding protein 278, Actin-binding-like protein, Filamin homolog 1, FLN1L, FLN3, FH1, Filamin-3, LRS1, TAP, Thyroid autoantigen, Beta-filamin, Filamin B, beta, Filamin-B, FLN-B, TABP, Truncated ABP

TAP antibody LS-C335245 is an unconjugated rabbit polyclonal antibody to TAP (FLNB) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.

Clonality:	Polyclonal
NCBI:	2317
Buffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity:	Affinity purified
Form:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Dilute:	IHC (1:20 - 1:50), WB (1:500 - 1:1000)
Application Notes:	The predicted MW is 230-281kDa, while the observed MW by Western blot was 298kDa.

	Western blot analysis of extracts of HeLa cells.
	Immunohistochemistry of paraffin-embedded rat brain tissue.

* VAT and and shipping costs not included.
Errors and price changes excepted