Polyclonal Rabbit anti-Human POLR2L Antibody (IHC, IF, WB) LS-C335249

Catalog Number: LS-C335249-20
Article Name: Polyclonal Rabbit anti-Human POLR2L Antibody (IHC, IF, WB) LS-C335249
Biozol Catalog Number: LS-C335249-20
Supplier Catalog Number: LS-C335249-20
Alternative Catalog Number: LS-C335249-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-67 of human POLR2L (NP_066951.1). MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Conjugation: Unconjugated
Alternative Names: POLR2L, RBP10, RPABC5, RPB10, RPB7.6, RPB10 homolog, RPB10beta, HRPB7.6, HsRPB10b
POLR2L antibody LS-C335249 is an unconjugated rabbit polyclonal antibody to POLR2L from human. It is reactive with mouse and rat. Validated for IF, IHC and WB.
Clonality: Polyclonal
NCBI: 5441
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 7kDa, while the observed MW by Western blot was Refer to Figures.
Western blot analysis of extracts of Raji cells.
Immunohistochemistry of paraffin-embedded rat brain tissue.
Immunofluorescence analysis of HeLa cells.