Polyclonal Rabbit anti-Human P2RY4 / P2Y4 Antibody (IHC, WB) LS-C335292

Catalog Number: LS-C335292-20
Article Name: Polyclonal Rabbit anti-Human P2RY4 / P2Y4 Antibody (IHC, WB) LS-C335292
Biozol Catalog Number: LS-C335292-20
Supplier Catalog Number: LS-C335292-20
Alternative Catalog Number: LS-C335292-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 286-365 of human P2RY4 (NP_002556.1). VVYKVTRPLASANSCLDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTPRADRL
Conjugation: Unconjugated
Alternative Names: P2RY4, p2Y4, p2P, p2Y purinoceptor 4, Pyrimidinergic receptor p2ry4, NRU, Uridine nucleotide receptor, p2RY4, UNR
P2Y4 antibody LS-C335292 is an unconjugated rabbit polyclonal antibody to P2Y4 (P2RY4) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Clonality: Polyclonal
NCBI: 5030
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IHC (1:50 - 1:100), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 40kDa, while the observed MW by Western blot was 41kDa.
Western blot analysis of extracts of various cells.
Immunohistochemistry of paraffin-embedded Human lung cancer tissue.