Polyclonal Rabbit anti-Human GHRH Antibody (IHC, WB) LS-C335562

Catalog Number: LS-C335562-20
Article Name: Polyclonal Rabbit anti-Human GHRH Antibody (IHC, WB) LS-C335562
Biozol Catalog Number: LS-C335562-20
Supplier Catalog Number: LS-C335562-20
Alternative Catalog Number: LS-C335562-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-107 of human GHRH (NP_001171660.1). PPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHRNSQG
Conjugation: Unconjugated
Alternative Names: GHRH, INN, Sermorelin, Somatocrinin, Somatoliberin, Somatorelin, GHRF, GRF
GHRH antibody LS-C335562 is an unconjugated rabbit polyclonal antibody to GHRH from human. It is reactive with human and mouse. Validated for IHC and WB.
Clonality: Polyclonal
NCBI: 2691
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 12kDa, while the observed MW by Western blot was 15kDa.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded human liver cancer tissue.
494,00 €
20 µl
* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL