Polyclonal Rabbit anti-Human KTN1 / Kinectin Antibody (IHC, WB) LS-C335610

Catalog Number: LS-C335610-100
Article Name: Polyclonal Rabbit anti-Human KTN1 / Kinectin Antibody (IHC, WB) LS-C335610
Biozol Catalog Number: LS-C335610-100
Supplier Catalog Number: LS-C335610-100
Alternative Catalog Number: LS-C335610-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KTN1 (NP_001072989.1). MEFYESAYFIVLIPSIVITVIFLFFWLFMKETLYDEVLAKQKREQKLIPTKTDKKKAEKKKNKKKEIQNGNLHESDSESVPRDFKLSDALAVEDDQVAPV
Conjugation: Unconjugated
Alternative Names: KTN1, CG-1 antigen, CG1, Kinesin receptor, Kinectin, KNT, KIAA0004, Kinectin 1 (kinesin receptor), MU-RMS-40.19
Kinectin antibody LS-C335610 is an unconjugated rabbit polyclonal antibody to human Kinectin (KTN1). Validated for IHC and WB.
Clonality: Polyclonal
NCBI: 3895
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 149kDa/150kDa/152kDa/156kDa, while the observed MW by Western blot was 166kDa.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded human liver injury tissue.